Viele Grüße, Malte 3 Kudos Antworten. { ], "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/235604","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dWU97-jjFCNYgzWT88oIjFYUyNbC8BfiXGYEPXg2PLE. }, $(document).ready(function() { "kudosLinksDisabled" : "false", "actions" : [ } { "eventActions" : [ { { ] "actions" : [ "action" : "pulsate" ] "initiatorDataMatcher" : "data-lia-message-uid" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ ] "action" : "rerender" }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", { { }, }, "event" : "unapproveMessage", }); { ;(function($) { } Leider gibt es keine Berichte, in denen o2 sich öffentlich kulant gezeigt hat. "event" : "removeMessageUserEmailSubscription", lithstudio: [], count++; "context" : "", "parameters" : { "actions" : [ "event" : "removeThreadUserEmailSubscription", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2178066 .lia-rating-control-passive', '#form_7'); "action" : "rerender" "actions" : [ "event" : "kudoEntity", "actions" : [ "actions" : [ "parameters" : { "message" : "2178063", "messageViewOptions" : "1111110111111111111110111110100101001101" Gesenkte MwSt.? }, Denk darüber nach. ] "actions" : [ } "actions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_38c846785f3cc6","nodesModel":{"2001|forum-board":{"title":"Board-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_38c846785f3cc6_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "kudosLinksDisabled" : "false", '; Erst mit der Kündigung hast du Anspruch auf die Auszahlung eines eventuellen Restguthabens auf deiner SIM-Karte und die Mitnahme deiner Rufnummer zu einem anderen Anbieter. LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); } "actions" : [ { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "action" : "rerender" })(LITHIUM.jQuery); }, } "action" : "rerender" "action" : "rerender" "action" : "rerender" "action" : "rerender" // Oops, not the right sequence, lets restart from the top. "event" : "approveMessage", "quiltName" : "ForumMessage", { } Hat da vielleicht jemand erfahrungen oder kann mir evtl. "displaySubject" : "true", "action" : "rerender" } "linkDisabled" : "false" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "eventActions" : [ "action" : "rerender" ] "event" : "ProductAnswer", return; "action" : "rerender" "quiltName" : "ForumMessage", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", } }, $(document).ready(function(){ } "event" : "markAsSpamWithoutRedirect", "useTruncatedSubject" : "true", "action" : "rerender" ] "event" : "addThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "context" : "", "context" : "", }, "action" : "rerender" "context" : "envParam:quiltName", "truncateBodyRetainsHtml" : "false", ] "action" : "rerender" { { { "event" : "ProductAnswer", }, Noch heute online versenden! "actions" : [ "actions" : [ ] } }, "action" : "rerender" ] Seitdem mache ich mir bei allen Verträgen, die ich abschließe einen Eintrag im Kalender mit den Kündigungszeiten/-fristen. "actions" : [ "action" : "rerender" "actions" : [ "context" : "envParam:selectedMessage", "showCountOnly" : "false", { { } ;(function($) { "action" : "rerender" "actions" : [ "action" : "rerender" "action" : "rerender" "kudosLinksDisabled" : "false", }, Wie lange ist die Kündigungsfrist bei Vodafone im Todesfall? }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); } $(document).ready(function(){ { "linkDisabled" : "false" count = 0; element.removeClass('active'); "selector" : "#kudosButtonV2_4", "actions" : [ { "parameters" : { "action" : "pulsate" "actions" : [ "action" : "rerender" "context" : "", } "includeRepliesModerationState" : "false", "useSimpleView" : "false", "event" : "MessagesWidgetEditAction", { "actions" : [ "action" : "rerender" { "context" : "", { LITHIUM.AjaxSupport.useTickets = false; { "action" : "rerender" "event" : "unapproveMessage", { ] "context" : "", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'gFQJkJKR6Ww4xBFsAfWna1M1zkejqiNSREtrbvw7pX4. { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", watching = false; "eventActions" : [ "actions" : [ "actions" : [ { ] "context" : "envParam:entity", }, "actions" : [ "truncateBody" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", var keycodes = { ] count++; "context" : "envParam:selectedMessage", "parameters" : { "quiltName" : "ForumMessage", }, "actions" : [ { { ] "showCountOnly" : "false", "context" : "", { //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "action" : "rerender" }, LITHIUM.Auth.CHECK_SESSION_TOKEN = 'TCvvq9N7myPjrB9V_gVCoA_93UtB9NwtL1KFog3mN4o. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { } "event" : "MessagesWidgetEditAction", "actions" : [ "context" : "", "actions" : [ "action" : "rerender" "event" : "deleteMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2177689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. © Copyright 2021 Kuendigung.org | Alle Rechte vorbehalten. } "action" : "rerender" "action" : "rerender" { "kudosable" : "true", } { "context" : "lia-deleted-state", "action" : "rerender" ] { "actions" : [ } { "componentId" : "kudos.widget.button", "event" : "MessagesWidgetCommentForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ } { ] ] { "action" : "rerender" Der Vertrag kann dann zum Sterbetag des Vertragsinhabers gekündigt werden. { "actions" : [ { "action" : "rerender" "quiltName" : "ForumMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosable" : "true", { "action" : "rerender" { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "action" : "rerender" "action" : "rerender" ] "action" : "rerender" ], ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});